PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla018312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family TCP
Protein Properties Length: 206aa    MW: 22074.9 Da    PI: 8.0236
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla018312genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP115.76.2e-3653130683
        TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                ++++++hTkv+gR+RRvR++a+caar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt++ +a   ++ s   ++s
  Cla018312  53 SSSKDRHTKVNGRGRRVRMPALCAARIFQLTRELGHRSDGETIEWLLRQAEPSIIAATGTGTVPAAPISTISPAMASS 130
                689*********************************************************777763332222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.3E-3154167IPR005333Transcription factor, TCP
PROSITE profilePS5136927.85355109IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MVSEIILHKF PSPSDHHSQP TASHSIVGSN SSPATITHQS LVPRKSTASL SSSSSKDRHT  60
KVNGRGRRVR MPALCAARIF QLTRELGHRS DGETIEWLLR QAEPSIIAAT GTGTVPAAPI  120
STISPAMASS ARSVSCRVQP VTVGGGGQGM FAMPPPSCRL DLCQPVGMEY SAAGSDYRHM  180
PFTALLLQPS TAEEAEERQE EEVFRE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143267.11e-120PREDICTED: transcription factor TCP11-like
SwissprotQ9SJK75e-46TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A0A0KH861e-117A0A0A0KH86_CUCSA; Uncharacterized protein
STRINGVIT_08s0040g01600.t011e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.18e-39TCP family protein